PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P21700_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 744aa    MW: 80485.8 Da    PI: 5.8316
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P21700_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox38.91.5e-1297141145
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHH CS
                Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVk 45 
                             ++k +++t++q++eLe+lF+++++p++++r eL+k+l L+ rq +
  GSMUA_Achr11P21700_001  97 KKKYHRHTPQQIQELEALFKECPHPDEKQRMELSKRLCLEPRQTQ 141
                             79999*************************************976 PP

2START1854e-582544781205
                             HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S CS
                   START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla 77 
                             ela++a++elvk+a+ eep+W  s     e +n+ e+ + f++  v      + +ea r++g+v+ ++  lve+l+d + +W  +++
  GSMUA_Achr11P21700_001 254 ELALAAMDELVKMAEMEEPLWIPSLdagrETLNYVEYDRCFPRC-VgakpngFASEATRETGLVIINSSALVETLMDAA-RWADMFP 338
                             5899*********************6677666666666666554.26999999**************************.******* PP

                             ....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEE CS
                   START  78 ....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgi 152
                                 ka+  +vissg      galqlm aelq+lsplvp Rd+ f+R+++ql++g w+ivdvS+d  + +p+  +  + +++lpSg+
  GSMUA_Achr11P21700_001 339 sviaKATAADVISSGmaatrnGALQLMHAELQVLSPLVPvRDVSFLRFCKQLSEGAWAIVDVSIDGIRGNPSaPPAKMTCRRLPSGC 425
                             ***********************************************************************98889999******** PP

                             EEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                   START 153 liepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                             ++++++ng+skvtwveh+++++ ++h l+r+l++sgla ga++wvatlqrqc+
  GSMUA_Achr11P21700_001 426 VVQDMPNGYSKVTWVEHAEYDETTVHPLYRPLLRSGLALGARRWVATLQRQCQ 478
                             ****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-1382141IPR009057Homeodomain-like
SuperFamilySSF466894.28E-1186141IPR009057Homeodomain-like
PROSITE profilePS500719.0794142IPR001356Homeobox domain
SMARTSM003890.004596154IPR001356Homeobox domain
PfamPF000465.1E-1097141IPR001356Homeobox domain
CDDcd000863.89E-1097141No hitNo description
PROSITE profilePS5084845.823245482IPR002913START domain
SuperFamilySSF559611.28E-31249480No hitNo description
CDDcd088751.97E-120251478No hitNo description
PfamPF018526.7E-50254478IPR002913START domain
SMARTSM002347.3E-38254479IPR002913START domain
Gene3DG3DSA:3.30.530.203.3E-4350475IPR023393START-like domain
SuperFamilySSF559611.08E-21499703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MPYGSSAALP AGAISHPPLL SPSLHKSIFS SPGLSLALQT NLDAHRDRNL VPAVGGDGED  60
LDSARRRKQD ENDSRSGSDN LEGGSEDDLE LENPRKKKKY HRHTPQQIQE LEALFKECPH  120
PDEKQRMELS KRLCLEPRQT QMERYENSIL KQENDKLRAE NLSIREAMRN PMCCNCGGPV  180
VLGEISLEEQ HLRIEYARLK DELDRVCALA GKFLGKPVSA LAGPLALPTP NSSLELAVAI  240
GGVDTSQEKF VFLELALAAM DELVKMAEME EPLWIPSLDA GRETLNYVEY DRCFPRCVGA  300
KPNGFASEAT RETGLVIINS SALVETLMDA ARWADMFPSV IAKATAADVI SSGMAATRNG  360
ALQLMHAELQ VLSPLVPVRD VSFLRFCKQL SEGAWAIVDV SIDGIRGNPS APPAKMTCRR  420
LPSGCVVQDM PNGYSKVTWV EHAEYDETTV HPLYRPLLRS GLALGARRWV ATLQRQCQSL  480
AILMSSSLSH DDNTGESVTP SGRRSMLKLA QRMTDNFCAG VCASSAREWN KLGGGVNIGE  540
DVRVMTRQSV ADPGEPPGVV LSAATSVWLP LSPQRLFDFL RNEQLRSQWD ILSNGGPMQE  600
MAHIAKGQNT GNAVSLLRAS AVSASQSSML ILQETCTDAS GSLVVYAPVD TPAMHLVMSG  660
GDSAYVALLP SGFAILPDGS GGGARKAGGS LLTVAFQILV NSQPTAKLTV ESVETVNNLI  720
SCTVQKIKAA LNCEPSKLDC YLKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009384534.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM0RUA00.0M0RUA0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P21700_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein